RPS2 Antibody (3G6)

Images

 
Western Blot: RPS2 Antibody (3G6) [H00006187-M01] - RPS2 monoclonal antibody (M01), clone 3G6. Analysis of RPS2 expression in human liver.
Immunocytochemistry/ Immunofluorescence: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.2 ug/ml.
ELISA: RPS2 Antibody (3G6) [H00006187-M01] - Detection limit for recombinant GST tagged RPS2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPS2 Antibody (3G6) Summary

Immunogen
RPS2 (NP_002943, 198 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Localization
Cytoplasmic ribosomal
Specificity
RPS2 - ribosomal protein S2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publication using H00006187-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS2 Antibody (3G6)

  • LLREP3
  • MGC102851
  • MGC117344
  • MGC117345,40S ribosomal protein S4
  • OK/KNS-cl.6,40S ribosomal protein S2
  • Protein LLRep3
  • ribosomal protein S2
  • RPS4

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-19933
Species: Hu, Mu
Applications: WB, IP
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
H00011329-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-90816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, PAGE, KO
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for RPS2 Antibody (H00006187-M01)(1)


Reviews for RPS2 Antibody (H00006187-M01) (0)

There are no reviews for RPS2 Antibody (H00006187-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS2 Antibody (H00006187-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPS2 Products

Bioinformatics Tool for RPS2 Antibody (H00006187-M01)

Discover related pathways, diseases and genes to RPS2 Antibody (H00006187-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS2 Antibody (H00006187-M01)

Discover more about diseases related to RPS2 Antibody (H00006187-M01).
 

Pathways for RPS2 Antibody (H00006187-M01)

View related products by pathway.

PTMs for RPS2 Antibody (H00006187-M01)

Learn more about PTMs related to RPS2 Antibody (H00006187-M01).

Blogs on RPS2

There are no specific blogs for RPS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS2 Antibody (3G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS2
Entrez
OMIM
Uniprot