Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5)

Images

 
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - KPNA1 monoclonal antibody (M01), clone 2A4-1B5 Analysis of KPNA1 expression in HeLa.
Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Analysis of monoclonal antibody to KPNA1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Analysis of KPNA1 expression in transfected 293T cell line by KPNA1 monoclonal antibody (M01), clone 2A4-1B5.Lane 1: KPNA1 transfected ...read more
Sandwich ELISA: Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) [H00003836-M01] - Detection limit for recombinant GST tagged KPNA1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2A4-1B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5) Summary

Immunogen
KPNA1 (AAH02374.1, 1 a.a. - 538 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Specificity
KPNA1 - karyopherin alpha 1 (importin alpha 5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KPNA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. ICC/IF usage reported in scientific literature (PMID: 21741962).
Reviewed Applications
Read 1 Review rated 5
using
H00003836-M01 in the following applications:

Publications
Read Publications using
H00003836-M01 in the following applications:

  • IP
    1 publication

Reactivity Notes

Rat reactivity reported in customer review.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Importin alpha 5/KPNA1/SRP1 Antibody (2A4-1B5)

  • Importin alpha 5
  • importin subunit alpha-1
  • importin-alpha-S1
  • IPOA5
  • karyopherin alpha 1 (importin alpha 5)
  • Karyopherin subunit alpha-1
  • KPNA1
  • NPI-1
  • NPI-1SRP1importin alpha 5
  • Nucleoprotein interactor 1
  • RCH2
  • RCH2RAG cohort protein 2
  • recombination activating gene cohort 2
  • SRP1
  • SRP1-beta

Background

Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP1-31260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-07799
Species: Hu
NBP1-74190
Species: Mu
Applications: WB, ChIP
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-81650
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83762
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003836-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01)(6)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00003836-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Human 07/01/2009
View

Summary

ApplicationWestern Blot
Sample TestedHuman intestinal epithelial cell (Caco2), Sample Amount: 40 ug
SpeciesHuman
Lot08218-S1

Blocking

Blocking DetailsBlocking Buffer: 5% Milk, Blocking Time: 1 hour, Blocking Temp: 25 degrees Celsius

Primary Anitbody

Dilution RatioDilution Ratio: 1/500, Incubation Dilution Buffer: 5% milk, Incubation Time: overnight, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Mouse HRP

Details

Detection NotesDetection Method: ECL - film, Exposure Time: 1 minute, Specific Bands: 60 kDa, Non-Specific Bands: 25 kDa

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin alpha 5/KPNA1/SRP1 Products

Bioinformatics Tool for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01)

Discover related pathways, diseases and genes to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01)

Discover more about diseases related to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01).
 

Pathways for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01)

View related products by pathway.

PTMs for Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01)

Learn more about PTMs related to Importin alpha 5/KPNA1/SRP1 Antibody (H00003836-M01).

Blogs on Importin alpha 5/KPNA1/SRP1

There are no specific blogs for Importin alpha 5/KPNA1/SRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
07/01/2009
Application: WB
Species: Human

Bioinformatics

Gene Symbol KPNA1
Entrez
OMIM
Uniprot