RRM2 Antibody

Images

 
Western Blot: RRM2 Antibody [NBP1-58189] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, Bv, Ca, Eq, GPSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRM2 Antibody Summary

Immunogen
Synthetic peptides corresponding to RRM2(ribonucleotide reductase M2 polypeptide) The peptide sequence was selected from the N terminal of RRM2. Peptide sequence PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP.
Specificity
This product is specific to Subunit or Isoform: M2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RRM2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RRM2 Antibody

  • EC 1.17.4.1
  • R2
  • ribonucleoside-diphosphate reductase subunit M2
  • ribonucleotide reductase M2 polypeptide
  • ribonucleotide reductase M2
  • Ribonucleotide reductase small chain
  • Ribonucleotide reductase small subunit
  • RR2
  • RR2M

Background

RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65315
Species: Bv, Ca, Eq, Gt, Sh
Applications: Flow, IHC, IHC-Fr, IP
NBP2-46198
Species: Hu
Applications: WB, IHC
MAB6979
Species: Hu
Applications: WB
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP2-57642
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76781
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-58189
Species: Hu, Rt, Bv, Ca, Eq, GP
Applications: WB

Publications for RRM2 Antibody (NBP1-58189) (0)

There are no publications for RRM2 Antibody (NBP1-58189).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRM2 Antibody (NBP1-58189) (0)

There are no reviews for RRM2 Antibody (NBP1-58189). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RRM2 Antibody (NBP1-58189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RRM2 Products

Bioinformatics Tool for RRM2 Antibody (NBP1-58189)

Discover related pathways, diseases and genes to RRM2 Antibody (NBP1-58189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRM2 Antibody (NBP1-58189)

Discover more about diseases related to RRM2 Antibody (NBP1-58189).
 

Pathways for RRM2 Antibody (NBP1-58189)

View related products by pathway.

PTMs for RRM2 Antibody (NBP1-58189)

Learn more about PTMs related to RRM2 Antibody (NBP1-58189).
 

Research Areas for RRM2 Antibody (NBP1-58189)

Find related products by research area.

Blogs on RRM2

There are no specific blogs for RRM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRM2
Uniprot