Novus Biologicals products are now on bio-techne.com

RPP40 Antibody - Azide and BSA Free

Images

 
Western Blot: RPP40 Antibody [NBP2-93071] - Analysis of extracts of various cell lines, using RPP40 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

RPP40 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human RPP40 (NP_001273061). LSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPP40
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for RPP40 Antibody - Azide and BSA Free

  • bA428J1.3,40kD subunit
  • EC 3.1.26.5
  • ribonuclease P/MRP 40kDa subunit
  • RNaseP protein p40

Background

RPP40 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57072
Species: Hu, Mu
Applications: WB
NBP1-92282
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93628
Species: Mu, Rt
Applications: WB
NBP2-93109
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-94050
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80658
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: IHC, IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-92349
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00079897-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-56076
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-03971
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P, WB
AF4986
Species: Hu
Applications: IHC
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for RPP40 Antibody (NBP2-93071) (0)

There are no publications for RPP40 Antibody (NBP2-93071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP40 Antibody (NBP2-93071) (0)

There are no reviews for RPP40 Antibody (NBP2-93071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPP40 Antibody (NBP2-93071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPP40 Products

Research Areas for RPP40 Antibody (NBP2-93071)

Find related products by research area.

Blogs on RPP40

There are no specific blogs for RPP40, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP40 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP40