RPP30 Antibody

Immunocytochemistry/Immunofluorescence: RPP30 Antibody [NBP1-80658] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli and microtubule ends.

Immunohistochemistry-Paraffin: RPP30 Antibody [NBP1-80658] - Staining in human testis and pancreas tissues using anti-RPP30 antibody. Corresponding RPP30 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: RPP30 Antibody [NBP1-80658] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: RPP30 Antibody [NBP1-80658] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

RPP30 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPP30
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPP30 Protein (NBP1-80658PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPP30 Antibody

• EC 3.1.26.5
• FLJ38491
• ribonuclease P (30kD) (RPP30)
• ribonuclease P protein subunit p30
• ribonuclease P/MRP 30kDa subunit
• RNase P subunit 2
• RNaseP protein p30
• RNASEP2
• TSG15

Background

RPP30 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPP30 Antibody (NBP1-80658)(2)

Publications using NBP1-80658

• Laoukili J, van Schelven S, Kucukkose E et al. BRAFV600E in colorectal cancer reduces sensitivity to oxidative stress and promotes site-specific metastasis by stimulating glutathione synthesis Cell reports 2022-11-29 [PMID: 36450250] (WB, Human)
• Li N, Xu Y, Chen H et al. NEIL3 contributes to the Fanconi anemia/BRCA pathway by promoting the downstream double-strand break repair step Cell reports 2022-11-08 [PMID: 36351389] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: RPP30
• Entrez:
  • 10556(Human)
• Uniprot:
  • P78346(Human)