RPP30 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPP30 Antibody [NBP1-80658] - Staining of human cell line U-251 MG shows localization to nucleus, nucleoli and microtubule ends.
Immunohistochemistry-Paraffin: RPP30 Antibody [NBP1-80658] - Staining in human testis and pancreas tissues using anti-RPP30 antibody. Corresponding RPP30 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RPP30 Antibody [NBP1-80658] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: RPP30 Antibody [NBP1-80658] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPP30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG
Specificity
Specificity of human RPP30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPP30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPP30 Protein (NBP1-80658PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPP30 Antibody

  • EC 3.1.26.5
  • FLJ38491
  • ribonuclease P (30kD) (RPP30)
  • ribonuclease P protein subunit p30
  • ribonuclease P/MRP 30kDa subunit
  • RNase P subunit 2
  • RNaseP protein p30
  • RNASEP2
  • TSG15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66088
Species: Hu
NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26606
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP, ICC
NBP1-92282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00079897-P01
Species: Hu
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88765
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-60052
Species: Hu
Applications: WB
NBP1-92349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56076
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-83286
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-88995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89688
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RPP30 Antibody (NBP1-80658) (0)

There are no publications for RPP30 Antibody (NBP1-80658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPP30 Antibody (NBP1-80658) (0)

There are no reviews for RPP30 Antibody (NBP1-80658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPP30 Antibody (NBP1-80658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RPP30 Antibody (NBP1-80658)

Discover related pathways, diseases and genes to RPP30 Antibody (NBP1-80658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPP30 Antibody (NBP1-80658)

Discover more about diseases related to RPP30 Antibody (NBP1-80658).
 

Pathways for RPP30 Antibody (NBP1-80658)

View related products by pathway.

PTMs for RPP30 Antibody (NBP1-80658)

Learn more about PTMs related to RPP30 Antibody (NBP1-80658).

Blogs on RPP30

There are no specific blogs for RPP30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPP30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPP30