POP7 Antibody

Images

 
Western Blot: POP7 Antibody [NBP1-92282] - Analysis in control (vector only transfected HEK293T lysate) and POP7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: POP7 Antibody [NBP1-92282] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POP7 Antibody [NBP1-92282] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: POP7 Antibody [NBP1-92282] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: POP7 Antibody [NBP1-92282] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICCIF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POP7 Protein (NBP1-92282PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POP7 Antibody

  • 0610037N12Rik
  • EC 3.1.26.5
  • hPOP7
  • processing of precursor 7, ribonuclease P subunit (S. cerevisiae)
  • processing of precursor 7, ribonuclease P subunit
  • processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
  • ribonuclease P protein subunit p20
  • Ribonucleases P/MRP protein subunit POP7 homolog
  • RNaseP protein p20
  • RPP20S. cerevisiae) homolog

Background

POP7 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POP7 Antibody (NBP1-92282) (0)

There are no publications for POP7 Antibody (NBP1-92282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POP7 Antibody (NBP1-92282) (0)

There are no reviews for POP7 Antibody (NBP1-92282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POP7 Antibody (NBP1-92282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POP7 Products

Research Areas for POP7 Antibody (NBP1-92282)

Find related products by research area.

Blogs on POP7

There are no specific blogs for POP7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POP7