![Western Blot: RPA4 Antibody [H00029935-D01P] - Analysis of RPA4 expression in human kidney.](http://images.novusbio.com/fullsize/RPA4-Antibody-Western-Blot-H00029935-D01P-img0001.jpg "Western Blot: RPA4 Antibody [H00029935-D01P] - Analysis of RPA4 expression in human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit RPA4 Antibody - Azide and BSA Free (H00029935-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | RPA4 (NP_037479.1, 1 a.a. - 261 a.a.) full-length human protein. MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPA4 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Immunocytochemistry/ Immunofluorescence RPA2 [p Ser4, p Ser8] Antibody - BSA Free](https://images.novusbio.com/images/RPA2-[p-Ser4--p-Ser8]-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-23017-img0046.jpg)
![Western Blot RPA2 [p Ser4, p Ser8] Antibody - BSA Free](https://images.novusbio.com/images/RPA2-[p-Ser4--p-Ser8]-Antibody-Western-Blot-NBP1-23017-img0047.jpg)
![Immunoprecipitation RPA2 [p Ser4, p Ser8] Antibody - BSA Free](https://images.novusbio.com/images/RPA2-[p-Ser4--p-Ser8]-Antibody-Immunoprecipitation-NBP1-23017-img0048.jpg)
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPA4 |
| Uniprot |
|
![Western Blot: RPA4 Antibody [H00029935-D01P] - Analysis of RPA4 expression in transfected 293T cell line by RPA4 polyclonal antibody.Lane 1: RPA4 transfected lysate(28.90 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RPA4-Antibody-Western-Blot-H00029935-D01P-img0002.jpg "Western Blot: RPA4 Antibody [H00029935-D01P] - Analysis of RPA4 expression in transfected 293T cell line by RPA4 polyclonal antibody.Lane 1: RPA4 transfected lysate(28.90 KDa).Lane 2: Non-transfected lysate.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")