RP105/CD180 Recombinant Protein Antigen

Images

 
There are currently no images for RP105/CD180 Protein (NBP1-87727PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

RP105/CD180 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD180.

Source: E. coli

Amino Acid Sequence: DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD180
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87727.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RP105/CD180 Recombinant Protein Antigen

  • CD180 antigenMGC126233
  • CD180 molecule
  • CD180
  • Ly64
  • LY64MGC126234
  • Ly78
  • Lymphocyte antigen 64
  • lymphocyte antigen-64, radioprotective, 105kDa
  • Radioprotective 105 kDa protein
  • RP105
  • RP105lymphocyte antigen 64 (mouse) homolog, radioprotective, 105kD

Background

CD180, also known as RP105, is a 105 kD member of the toll-like receptor (TLR) family and is expressed on most B cells, monocytes/macrophages and dendritic cells. The TLR family's structural characteristics are critically involved in protein-protein signaling interactions leading to the activation of the innate immune system. Additionally, MD-1, a secretory protein, associates with CD180 (RP105) at the cell surface and this complex, in conjunction with TLR4, recognizes bacterial LPS. The human CD180 (RP105) gene maps to 5q12. The MHR73-11 antibody is able to activate B cells and to protect against irradiation- or dexamethasone-induced apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-56700
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
1787-MD
Species: Hu
Applications: Bind
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
DC140
Species: Hu
Applications: ELISA
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
DY417
Species: Mu
Applications: ELISA
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP2-24729
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC,  IHC-P, IP, In vitro, KD, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA

Publications for RP105/CD180 Protein (NBP1-87727PEP) (0)

There are no publications for RP105/CD180 Protein (NBP1-87727PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RP105/CD180 Protein (NBP1-87727PEP) (0)

There are no reviews for RP105/CD180 Protein (NBP1-87727PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RP105/CD180 Protein (NBP1-87727PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RP105/CD180 Products

Research Areas for RP105/CD180 Protein (NBP1-87727PEP)

Find related products by research area.

Blogs on RP105/CD180

There are no specific blogs for RP105/CD180, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RP105/CD180 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD180