RP105/CD180 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RP105/CD180 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD180.
  
  

  Source: E. coli

  Amino Acid Sequence: DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD180
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87727.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RP105/CD180 Recombinant Protein Antigen

• CD180 antigenMGC126233
• CD180 molecule
• CD180
• Ly64
• LY64MGC126234
• Ly78
• Lymphocyte antigen 64
• lymphocyte antigen-64, radioprotective, 105kDa
• Radioprotective 105 kDa protein
• RP105
• RP105lymphocyte antigen 64 (mouse) homolog, radioprotective, 105kD

Background

CD180, also known as RP105, is a 105 kD member of the toll-like receptor (TLR) family and is expressed on most B cells, monocytes/macrophages and dendritic cells. The TLR family's structural characteristics are critically involved in protein-protein signaling interactions leading to the activation of the innate immune system. Additionally, MD-1, a secretory protein, associates with CD180 (RP105) at the cell surface and this complex, in conjunction with TLR4, recognizes bacterial LPS. The human CD180 (RP105) gene maps to 5q12. The MHR73-11 antibody is able to activate B cells and to protect against irradiation- or dexamethasone-induced apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD180