RNF6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: RNF6 Antibody [NBP1-84107] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane & vesicles.

Immunohistochemistry-Paraffin: RNF6 Antibody [NBP1-84107] - Staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RNF6 Antibody - BSA Free (NBP1-84107) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELRQREGQRFGAAHVWENGARSNVTVRNTNQRLEPIRLRST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF6 Protein (NBP1-84107PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RNF6 Antibody - BSA Free

• DKFZp686P0776
• E3 ubiquitin-protein ligase RNF6
• EC 6.3.2.-
• ring finger protein (C3H2C3 type) 6
• RING-H2 protein RNF-6
• SPG2

Background

RNF6 is encoded by this gene contains a RING-H2 finger motif. Deletions and mutations in this gene were detected in esophageal squamous cell carcinoma (ESCC), suggesting that this protein may be a potential tumor suppressor. Studies of the mouse counterpart suggested a role of this protein in the transcription regulation that controls germinal differentiation. Multiple alternatively spliced transcript variants encoding the same protein are observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF6