RNF20 Antibody


Western Blot: RNF20 Antibody [NBP1-52985] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RNF20 Antibody Summary

Synthetic peptides corresponding to RNF20(ring finger protein 20) The peptide sequence was selected from the N terminal of RNF20. Peptide sequence LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RNF20 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF20 Antibody

  • BRE1 E3 ubiquitin ligase homolog
  • BRE1
  • BRE1-A
  • BRE1AMGC129667
  • E3 ubiquitin-protein ligase BRE1A
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ11189
  • FLJ20382
  • hBRE1MGC129668
  • homolog of S. cerevisiae BRE1
  • KAIA2779
  • ring finger protein 20KIAA2779


RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. The protein encoded by this gene shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is a ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Y, Ye
Applications: WB, ChIP, ELISA, ICC/IF, ChIP
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for RNF20 Antibody (NBP1-52985) (0)

There are no publications for RNF20 Antibody (NBP1-52985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF20 Antibody (NBP1-52985) (0)

There are no reviews for RNF20 Antibody (NBP1-52985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF20 Antibody (NBP1-52985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RNF20 Antibody (NBP1-52985)

Discover related pathways, diseases and genes to RNF20 Antibody (NBP1-52985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF20 Antibody (NBP1-52985)

Discover more about diseases related to RNF20 Antibody (NBP1-52985).

Pathways for RNF20 Antibody (NBP1-52985)

View related products by pathway.

PTMs for RNF20 Antibody (NBP1-52985)

Learn more about PTMs related to RNF20 Antibody (NBP1-52985).

Research Areas for RNF20 Antibody (NBP1-52985)

Find related products by research area.

Blogs on RNF20

There are no specific blogs for RNF20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNF20 Antibody and receive a gift card or discount.


Gene Symbol RNF20