RNF141 Antibody - BSA Free

Western Blot: RNF141 Antibody [NBP1-80603] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: RNF141 Antibody [NBP1-80603] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.

Immunohistochemistry-Paraffin: RNF141 Antibody [NBP1-80603] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal and glial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF141 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQLTDE
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF141
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF141 Protein (NBP1-80603PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNF141 Antibody - BSA Free

• C3HC4-like zinc finger protein
• MGC8715
• ring finger protein 141
• Zinc finger protein 230
• ZNF230ZFP26

Background

RNF141 is encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF141 Antibody (NBP1-80603)(2)

Publications using NBP1-80603

• Heijink AM, Stok C, Porubsky D et al. Sister chromatid exchanges induced by perturbed replication can form independently of BRCA1, BRCA2 and RAD51 Nature communications 2022-11-07 [PMID: 36344511] (WB, Human)
  
  Details:
  Dilution used in ICC 1:1000
• Mota A, Berezicki S, Wernersson E et al. FRET-FISH probes chromatin compaction at individual genomic loci in single cells Nature communications 2022-11-05 [PMID: 36335096] (ICC/IF, Mouse)
  
  Details:
  Dilution used in ICC 1:1000

Bioinformatics

• Gene Symbol: RNF141
• Entrez:
  • 50862(Human)