RNF12 Antibody - BSA Free

Immunohistochemistry: RNF12 Antibody [NBP3-10928] - Immunohistochemical analysis of human spermatophore.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RNF12 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF12 (NP_057204). Peptide sequence AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RLIM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 69 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RNF12 Antibody - BSA Free

• DKFZp686N06224
• E3 ubiquitin-protein ligase RLIM
• E3 ubiquitin-protein ligase RNF12
• EC 6.3.2
• EC 6.3.2.-
• FLJ25923
• FLJ41093
• LIM domain-interacting RING finger protein
• MGC15161
• NY-REN-43
• Renal carcinoma antigen NY-REN-43
• RING finger LIM domain-binding protein
• RING finger protein 12FLJ42887
• ring finger protein, LIM domain interacting
• ring zinc finger LIM domain binding protein
• ring zinc finger protein NY-REN-43antigen
• R-LIM
• RNF12FLJ45986

Background

RNF12 is encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RLIM