RND3 Antibody - BSA Free

Immunohistochemistry-Paraffin: RND3 Antibody [NBP2-49315] - Staining of human kidney shows moderate membranous and cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RND3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RND3 Antibody - BSA Free (NBP2-49315) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVL
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RND3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RND3 Recombinant Protein Antigen (NBP2-49315PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RND3 Antibody - BSA Free

• ARHE
• MemB
• Protein MemB
• Rho family GTPase 3member E
• Rho8
• RHOE
• Rho-related GTP-binding protein Rho8
• rho-related GTP-binding protein RhoE
• RND3
• small GTP binding protein Rho8

Background

RND3 is a gene that codes for a protein that binds GTP but is resistant to Rho-specific GTPase-activating proteins as well as lacks certain GTPase activities, and is 244 amino acids long and weighs approximately 27 kDa. Current studies are being done on several diseases and disorders relating to this gene including colon, gastric, lung and prostate cancers, glioblastoma, hypoxia, prostatitis, melanoma, and carcinoma. RND3 has also been shown to have interactions with SFN, ARHGAP5, PLXNB1, ROCK1, and UBXN11 in pathways such as the cytoskeletal signaling and selected targets of CREB1 and p53 pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RND3