RNASE6 Antibody

Images

 
Immunohistochemistry-Paraffin: RNASE6 Antibody [NBP1-80822] - Staining of human tonsil shows strong cytoplasmic positivity in a rare subset of non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNASE6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKRITKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPV
Specificity
Specificity of human RNASE6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASE6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNASE6 Antibody

  • EC 3.1.27
  • EC 3.1.27.-
  • EC 3.1.27.5
  • ribonuclease K6
  • ribonuclease, RNase A family, k6
  • RNase K6
  • RNasek6
  • RNS6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NBP2-76905
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-648
Species: Bv
Applications: WB, ELISA, IP
NBP2-57697
Species: Hu, Mu
Applications: IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
AF2905
Species: Hu
Applications: WB, ELISA, ICC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-80822
Species: Hu
Applications: IHC, IHC-P

Publications for RNASE6 Antibody (NBP1-80822) (0)

There are no publications for RNASE6 Antibody (NBP1-80822).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNASE6 Antibody (NBP1-80822) (0)

There are no reviews for RNASE6 Antibody (NBP1-80822). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNASE6 Antibody (NBP1-80822) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNASE6 Products

Bioinformatics Tool for RNASE6 Antibody (NBP1-80822)

Discover related pathways, diseases and genes to RNASE6 Antibody (NBP1-80822). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNASE6 Antibody (NBP1-80822)

Discover more about diseases related to RNASE6 Antibody (NBP1-80822).
 

Pathways for RNASE6 Antibody (NBP1-80822)

View related products by pathway.

Blogs on RNASE6

There are no specific blogs for RNASE6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNASE6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE6
Entrez
Novus 100% Guarantee