RNase H1 Antibody


Immunohistochemistry: RNase H1 Antibody [NBP2-38501] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

RNase H1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRL
Specificity of human RNase H1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNase H1 Protein (NBP2-38501PEP)
Read Publications using
NBP2-38501 in the following applications:

  • PLA
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RNase H1 Antibody

  • EC
  • H1RNA
  • Ribonuclease H type II
  • ribonuclease H1
  • RNase H1
  • RNH1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, ICC, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for RNase H1 Antibody (NBP2-38501)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: PLA.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for RNase H1 Antibody (NBP2-38501) (0)

There are no reviews for RNase H1 Antibody (NBP2-38501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RNase H1 Antibody (NBP2-38501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for RNase H1 Antibody (NBP2-38501)

Discover related pathways, diseases and genes to RNase H1 Antibody (NBP2-38501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNase H1 Antibody (NBP2-38501)

Discover more about diseases related to RNase H1 Antibody (NBP2-38501).

Pathways for RNase H1 Antibody (NBP2-38501)

View related products by pathway.

PTMs for RNase H1 Antibody (NBP2-38501)

Learn more about PTMs related to RNase H1 Antibody (NBP2-38501).

Blogs on RNase H1

There are no specific blogs for RNase H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RNase H1 Antibody and receive a gift card or discount.


Gene Symbol RNASEH1