RNA Helicase A Antibody

Images

 
Western Blot: RNA Helicase A Antibody [NBP2-56889] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNA Helicase A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGKLAQFEPSQ
Specificity
Specificity of human RNA Helicase A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHX9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
Control Peptide
RNA Helicase A Recombinant Protein Antigen (NBP2-56889PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RNA Helicase A Antibody

  • DDX9ATP-dependent RNA helicase A
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9
  • DEAH (Asp-Glu-Ala-His) box polypeptide 9
  • DEAH box protein 9
  • EC 3.6.1
  • EC 3.6.1.15
  • EC 3.6.4.13
  • FLJ17406
  • leukophysin
  • LKP
  • NDH II
  • NDH2
  • NDHII
  • Nuclear DNA helicase II
  • RHA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP
AF3757
Species: Hu
Applications: WB, ICC
AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-471
Species: Hu
Applications: WB, ICC/IF, IHC, IP, ChIP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
H00001392-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-75540
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5285
Species: Hu
Applications: WB, Simple Western
NB200-351
Species: Hu, Mu, Ha
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for RNA Helicase A Antibody (NBP2-56889) (0)

There are no publications for RNA Helicase A Antibody (NBP2-56889).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNA Helicase A Antibody (NBP2-56889) (0)

There are no reviews for RNA Helicase A Antibody (NBP2-56889). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNA Helicase A Antibody (NBP2-56889) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNA Helicase A Products

Bioinformatics Tool for RNA Helicase A Antibody (NBP2-56889)

Discover related pathways, diseases and genes to RNA Helicase A Antibody (NBP2-56889). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNA Helicase A Antibody (NBP2-56889)

Discover more about diseases related to RNA Helicase A Antibody (NBP2-56889).
 

Pathways for RNA Helicase A Antibody (NBP2-56889)

View related products by pathway.

PTMs for RNA Helicase A Antibody (NBP2-56889)

Learn more about PTMs related to RNA Helicase A Antibody (NBP2-56889).
 

Research Areas for RNA Helicase A Antibody (NBP2-56889)

Find related products by research area.

Blogs on RNA Helicase A

There are no specific blogs for RNA Helicase A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNA Helicase A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX9