RIP5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RIP5 Antibody [NBP2-33830] - Staining of human cell line PC-3 shows localization to cytosol.
Immunohistochemistry-Paraffin: RIP5 Antibody [NBP2-33830] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIP5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
Specificity
Specificity of human RIP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C20orf24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RIP5 Protein (NBP2-33830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIP5 Antibody

  • C20orf24
  • chromosome 20 open reading frame 24
  • PNAS-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30447
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-49174
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051497-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00055544-P01
Species: Hu
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Pm, Rb
Applications: WB, Flow
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP1-81706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33830
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RIP5 Antibody (NBP2-33830) (0)

There are no publications for RIP5 Antibody (NBP2-33830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIP5 Antibody (NBP2-33830) (0)

There are no reviews for RIP5 Antibody (NBP2-33830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIP5 Antibody (NBP2-33830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RIP5 Antibody (NBP2-33830)

Discover related pathways, diseases and genes to RIP5 Antibody (NBP2-33830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIP5 Antibody (NBP2-33830)

Discover more about diseases related to RIP5 Antibody (NBP2-33830).
 

Pathways for RIP5 Antibody (NBP2-33830)

View related products by pathway.

Blogs on RIP5

There are no specific blogs for RIP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C20orf24
Uniprot