RIN1 Antibody

Images

 
Western Blot: RIN1 Antibody [NBP1-85905] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-474
Immunohistochemistry-Paraffin: RIN1 Antibody [NBP1-85905] - Staining of human pancreas shows moderate cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RIN1 Protein (NBP1-85905PEP)
Publications
Read Publication using NBP1-85905.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25082076)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIN1 Antibody

  • Ras and Rab interactor 1
  • ras inhibitor 1
  • Ras inhibitor JC99
  • ras inhibitor RIN1
  • Ras interaction/interference protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5414
Species: Hu
Applications: WB, Simple Western
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49154
Species: Hu
Applications: IHC
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85905
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RIN1 Antibody (NBP1-85905)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for RIN1 Antibody (NBP1-85905) (0)

There are no reviews for RIN1 Antibody (NBP1-85905). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RIN1 Antibody (NBP1-85905) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIN1 Products

Bioinformatics Tool for RIN1 Antibody (NBP1-85905)

Discover related pathways, diseases and genes to RIN1 Antibody (NBP1-85905). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIN1 Antibody (NBP1-85905)

Discover more about diseases related to RIN1 Antibody (NBP1-85905).
 

Pathways for RIN1 Antibody (NBP1-85905)

View related products by pathway.

PTMs for RIN1 Antibody (NBP1-85905)

Learn more about PTMs related to RIN1 Antibody (NBP1-85905).
 

Research Areas for RIN1 Antibody (NBP1-85905)

Find related products by research area.

Blogs on RIN1

There are no specific blogs for RIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIN1