RIMS2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RIMS2 Antibody [NBP2-56512] - Analysis in human fallopian tube and pancreas tissues using HPA066498 antibody. Corresponding RIMS2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: RIMS2 Antibody [NBP2-56512] -Staining of human adrenal gland shows strong positivity in cytoplasm granular in glandular cells.
Immunohistochemistry-Paraffin: RIMS2 Antibody [NBP2-56512] - Staining of human fallopian tube shows moderate positivity in cytoplasm granular in glandular cells.
Immunohistochemistry-Paraffin: RIMS2 Antibody [NBP2-56512] -Staining of human testis shows weak positivity in cytoplasm granular in Leydig cells.
Immunohistochemistry-Paraffin: RIMS2 Antibody [NBP2-56512] - Staining of human kidney shows moderate positivity in cytoplasm granular in cells in tubules.
Immunohistochemistry-Paraffin: RIMS2 Antibody [NBP2-56512] -Staining of human pancreas shows negative positivity in cytoplasm granular in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RIMS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RIMS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RIMS2 Recombinant Protein Antigen (NBP2-56512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RIMS2 Antibody

  • DKFZp781A0653
  • KIAA0751RIM2OBOERAB3 interacting protein 3
  • non-small cell lung cancer RimL3a protein
  • non-small cell lung cancer RimL3c protein
  • nuclear protein
  • Rab-3-interacting molecule 2
  • rab3-interacting molecule 2
  • Rab-3-interacting protein 3
  • RAB3IP3
  • regulating synaptic membrane exocytosis 2
  • regulating synaptic membrane exocytosis protein 2
  • RIM 2

Background

Rab effector involved in exocytosis. May act as scaffold protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RIMS2 Antibody (NBP2-56512) (0)

There are no publications for RIMS2 Antibody (NBP2-56512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIMS2 Antibody (NBP2-56512) (0)

There are no reviews for RIMS2 Antibody (NBP2-56512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RIMS2 Antibody (NBP2-56512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIMS2 Products

Research Areas for RIMS2 Antibody (NBP2-56512)

Find related products by research area.

Blogs on RIMS2

There are no specific blogs for RIMS2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIMS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RIMS2