RPH3AL Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 161-315 of human RPH3AL (NP_008918.1). KYILPLKTPGRADDPHFRPLPTEPAEREPRSSETSRIYTWARGRVVSSDSDSDSDLSSSSLEDRLPSTGVRDRKGDKPWKESGGSVEAPRMGFTHPPGHLSGCQSSLASGETGTGSADPPGGPRPGLTRRAPVKDTPGRAPAADAAPAGPSSCLG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RPH3AL |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for RPH3AL Antibody
Background
Rab GTPase effector involved in the late steps of regulated exocytosis, both in endocrine and exocrine cells . Acts as a potential RAB3B effector protein in epithelial cells
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: WB
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF
Publications for RPH3AL Antibody (NBP2-94887) (0)
There are no publications for RPH3AL Antibody (NBP2-94887).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RPH3AL Antibody (NBP2-94887) (0)
There are no reviews for RPH3AL Antibody (NBP2-94887).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RPH3AL Antibody (NBP2-94887) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RPH3AL Products
Bioinformatics Tool for RPH3AL Antibody (NBP2-94887)
Discover related pathways, diseases and genes to RPH3AL Antibody (NBP2-94887). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for RPH3AL Antibody (NBP2-94887)
Discover more about diseases related to RPH3AL Antibody (NBP2-94887).
| | Pathways for RPH3AL Antibody (NBP2-94887)
View related products by pathway.
|
PTMs for RPH3AL Antibody (NBP2-94887)
Learn more about PTMs related to RPH3AL Antibody (NBP2-94887).
| | Research Areas for RPH3AL Antibody (NBP2-94887)
Find related products by research area.
|
Blogs on RPH3AL