Epac2 Antibody

Images

 
Western Blot: Epac2 Antibody [NBP2-32009] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Epac2 Antibody [NBP2-32009] - Staining of human cell line RT4 shows localization to focal adhesion sites.
Immunohistochemistry-Paraffin: Epac2 Antibody [NBP2-32009] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Epac2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAPGEF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Epac2 Protein (NBP2-32009PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Epac2 Antibody

  • CAMP-GEFII
  • cAMP-regulated guanine nucleotide exchange factor II
  • CGEF2EPAC 2
  • EPAC2
  • Exchange factor directly activated by cAMP 2
  • Exchange protein directly activated by cAMP 2
  • Nbla00496
  • putative protein product of Nbla00496
  • Rap guanine nucleotide exchange factor (GEF) 4
  • rap guanine nucleotide exchange factor 4
  • RAP guanine-nucleotide-exchange factor (GEF) 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24574
Species: Hu, Mu, Ca, Ch, Eq, Op, Pm, Xp
Applications: WB, IHC-P
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Epac2 Antibody (NBP2-32009) (0)

There are no publications for Epac2 Antibody (NBP2-32009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Epac2 Antibody (NBP2-32009) (0)

There are no reviews for Epac2 Antibody (NBP2-32009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Epac2 Antibody (NBP2-32009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Epac2 Products

Bioinformatics Tool for Epac2 Antibody (NBP2-32009)

Discover related pathways, diseases and genes to Epac2 Antibody (NBP2-32009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Epac2 Antibody (NBP2-32009)

Discover more about diseases related to Epac2 Antibody (NBP2-32009).
 

Pathways for Epac2 Antibody (NBP2-32009)

View related products by pathway.

PTMs for Epac2 Antibody (NBP2-32009)

Learn more about PTMs related to Epac2 Antibody (NBP2-32009).
 

Research Areas for Epac2 Antibody (NBP2-32009)

Find related products by research area.

Blogs on Epac2

There are no specific blogs for Epac2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Epac2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAPGEF4
Uniprot