![Western Blot: CTBP2 Antibody (1R1U6) [NBP3-15268] - Analysis of extracts of various cell lines, using CTBP2 antibody (NBP3-15268) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/CTBP2-Antibody-1R1U6-Western-Blot-NBP3-15268-img0007.jpg "Western Blot: CTBP2 Antibody (1R1U6) [NBP3-15268] - Analysis of extracts of various cell lines, using CTBP2 antibody (NBP3-15268) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP |
| Clone | 1R1U6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit CTBP2 Antibody (1R1U6) (NBP3-15268) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 346-445 of human CTBP2 (P56545). TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CTBP2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CTBP2 Antibody (NBP3-15268)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CTBP2 |
![Immunohistochemistry-Paraffin: CTBP2 Antibody (1R1U6) [NBP3-15268] - Rat ovary using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CTBP2-Antibody-1R1U6-Immunohistochemistry-Paraffin-NBP3-15268-img0003.jpg "Immunohistochemistry-Paraffin: CTBP2 Antibody (1R1U6) [NBP3-15268] - Rat ovary using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: CTBP2 Antibody (1R1U6) [NBP3-15268] - Immunofluorescence analysis of NIH/3T3 cells using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CTBP2-Antibody-1R1U6-Immunocytochemistry-Immunofluorescence-NBP3-15268-img0004.jpg "Immunocytochemistry/Immunofluorescence: CTBP2 Antibody (1R1U6) [NBP3-15268] - Immunofluorescence analysis of NIH/3T3 cells using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: CTBP2 Antibody (1R1U6) [NBP3-15268] - Human colon carcinoma using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CTBP2-Antibody-1R1U6-Immunohistochemistry-Paraffin-NBP3-15268-img0001.jpg "Immunohistochemistry-Paraffin: CTBP2 Antibody (1R1U6) [NBP3-15268] - Human colon carcinoma using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: CTBP2 Antibody (1R1U6) [NBP3-15268] - Mouse kidney using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CTBP2-Antibody-1R1U6-Immunohistochemistry-Paraffin-NBP3-15268-img0002.jpg "Immunohistochemistry-Paraffin: CTBP2 Antibody (1R1U6) [NBP3-15268] - Mouse kidney using CTBP2 Rabbit mAb (NBP3-15268) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunoprecipitation: CTBP2 Antibody (1R1U6) [NBP3-15268] - Analysis of 300ug extracts of Hela cells using 3ug CTBP2 antibody (NBP3-15268). Western blot was performed from the immunoprecipitate using CTBP2 (NBP3-15268) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/CTBP2-Antibody-1R1U6-Immunoprecipitation-NBP3-15268-img0008.jpg "Immunoprecipitation: CTBP2 Antibody (1R1U6) [NBP3-15268] - Analysis of 300ug extracts of Hela cells using 3ug CTBP2 antibody (NBP3-15268). Western blot was performed from the immunoprecipitate using CTBP2 (NBP3-15268) at a dilition of 1:1000.")
![Immunocytochemistry/ Immunofluorescence: CTBP2 Antibody (1R1U6) [CTBP2] - Immunofluorescence analysis of U2OS cells using CTBP2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15268_rabbit-ctbp2-mab-1r1u6-5220251726010.jpg "Immunocytochemistry/ Immunofluorescence: CTBP2 Antibody (1R1U6) [CTBP2] - Immunofluorescence analysis of U2OS cells using CTBP2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: CTBP2 Antibody (1R1U6) [CTBP2] - Immunofluorescence analysis of PC-12 cells using CTBP2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15268_rabbit-ctbp2-mab-1r1u6-52202517192921.jpg "Immunocytochemistry/ Immunofluorescence: CTBP2 Antibody (1R1U6) [CTBP2] - Immunofluorescence analysis of PC-12 cells using CTBP2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: CTBP2 Antibody (1R1U6) [CTBP2] - Immunofluorescence analysis of NIH/3T3 cells using CTBP2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15268_rabbit-ctbp2-mab-1r1u6-5220251721359.jpg "Immunocytochemistry/ Immunofluorescence: CTBP2 Antibody (1R1U6) [CTBP2] - Immunofluorescence analysis of NIH/3T3 cells using CTBP2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")