Novus Biologicals products are now on bio-techne.com

Piccolo Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Piccolo Antibody [NBP1-90250] - Staining of human cell line U-251 MG shows localization to nuclear speckles & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human cerebellum shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Piccolo Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PITTLDSITTVYTEPVDMITKFEDSEEISSSTYFPGSIIDYPEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPKPEGPVADTVSTDLLISEKDPVKKAKKETGNGIILEVLEA
Marker
Synaptic Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCLO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Piccolo Protein (NBP1-90250PEP)
Publications
Read Publication using NBP1-90250.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Piccolo Antibody

  • ACZ
  • Aczonin
  • PCLO
  • piccolo (presynaptic cytomatrix protein)
  • Piccolo
  • protein piccolo

Background

Piccolo is a presynaptic cytomatrix protein concentrated at the presynaptic side of synaptic junctions. Piccolo is a large protein which constists of an N-terminal Zn2+ finger, several piccolo-bassoon homology domains (PBH-domains) and C-terminal PDZ and C2 domains. It is usually found together with bassoon, a related huge multi-domain protein of the CAZ (cytoskeletal matric assembled at active zones). Piccolo is a scaffolding protein for proteins involved in endo- and exocytosis of synaptic vesicles. Recently piccolo has been shown to interfere with clathrin mediated endocytosis by binding to the F-actin and dynamin binding protein Abp1. Piccolo is highly expressed in brain with low levels found in stomach. It is not detected in other tissues analyzed including adrenal gland, testis and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB120-13249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-13395
Species: Mu, Rt
Applications: WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-33037
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19676
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-88177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00795
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-15268
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-56512
Species: Hu
Applications: IHC, IHC-P
NBP1-82964
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-32009
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92892
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

Publications for Piccolo Antibody (NBP1-90250)(1)

Reviews for Piccolo Antibody (NBP1-90250) (0)

There are no reviews for Piccolo Antibody (NBP1-90250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Piccolo Antibody (NBP1-90250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Piccolo Products

Research Areas for Piccolo Antibody (NBP1-90250)

Find related products by research area.

Blogs on Piccolo

There are no specific blogs for Piccolo, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Piccolo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCLO