Piccolo Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Piccolo Antibody [NBP1-90250] - Staining of human cell line U-251 MG shows localization to nuclear speckles & plasma membrane.
Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human cerebral cortex shows moderate positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Piccolo Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PITTLDSITTVYTEPVDMITKFEDSEEISSSTYFPGSIIDYPEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPKPEGPVADTVSTDLLISEKDPVKKAKKETGNGIILEVLEA
Marker
Synaptic Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCLO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Piccolo Protein (NBP1-90250PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Piccolo Antibody

  • ACZ
  • Aczonin
  • PCLO
  • piccolo (presynaptic cytomatrix protein)
  • Piccolo
  • protein piccolo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
MAB6188
Species: Hu
Applications: IHC
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP1-88177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-32009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Piccolo Antibody (NBP1-90250) (0)

There are no publications for Piccolo Antibody (NBP1-90250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Piccolo Antibody (NBP1-90250) (0)

There are no reviews for Piccolo Antibody (NBP1-90250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Piccolo Antibody (NBP1-90250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Piccolo Products

Bioinformatics Tool for Piccolo Antibody (NBP1-90250)

Discover related pathways, diseases and genes to Piccolo Antibody (NBP1-90250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Piccolo Antibody (NBP1-90250)

Discover more about diseases related to Piccolo Antibody (NBP1-90250).
 

Pathways for Piccolo Antibody (NBP1-90250)

View related products by pathway.

PTMs for Piccolo Antibody (NBP1-90250)

Learn more about PTMs related to Piccolo Antibody (NBP1-90250).

Blogs on Piccolo

There are no specific blogs for Piccolo, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Piccolo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCLO
Entrez