Ribosomal Protein L17 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ribosomal Protein L17. Source: E. coli
Amino Acid Sequence: RAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKISQKKLK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
RPL17 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48845. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Ribosomal Protein L17 Recombinant Protein Antigen
Background
Ribosomal Protein L17, also known as 60S ribosomal protein L23, is a 21kDa 184 amino acid protein with a shorter 17kDa 146 isoform and a longer 26kDa 228 isoform produced by alternative splicing. Ribosomal Protein L17 belongs to the L22P family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on Ribosomal Protein L17 and its relationship to Treacher Collins syndrome, gastric cancer, pancreatitis and malaria. Ribosomal Protein L17 has been linked to the ribosome assembly, protein folding, cell proliferation and cell growth pathways where it interacts with RPL4, RPL11, RPL26, RPL27A and RPL35.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, WB
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48845PEP) (0)
There are no publications for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48845PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48845PEP) (0)
There are no reviews for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48845PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48845PEP) (0)
Additional Ribosomal Protein L17 Products
Research Areas for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48845PEP)
Find related products by research area.
|
Blogs on Ribosomal Protein L17