Ribosomal Protein L17 Recombinant Protein Antigen

Images

 
There are currently no images for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ribosomal Protein L17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ribosomal Protein L17.

Source: E. coli

Amino Acid Sequence: KNTRETAQAIKGMHIRKATKYLKDVTLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQVNKAPKM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPL17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48798.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ribosomal Protein L17 Recombinant Protein Antigen

  • FLJ18762,60S ribosomal protein L23
  • FLJ92089
  • gene encoding putative NFkB activating protein
  • MGC117162
  • PD-1
  • Ribosomal Protein L17
  • RPL17
  • RPL23
  • RPL23,60S ribosomal protein L17

Background

Ribosomal Protein L17, also known as 60S ribosomal protein L23, is a 21kDa 184 amino acid protein with a shorter 17kDa 146 isoform and a longer 26kDa 228 isoform produced by alternative splicing. Ribosomal Protein L17 belongs to the L22P family of ribosomal proteins and can be found in the cytoplasm. Current research is being conducted on Ribosomal Protein L17 and its relationship to Treacher Collins syndrome, gastric cancer, pancreatitis and malaria. Ribosomal Protein L17 has been linked to the ribosome assembly, protein folding, cell proliferation and cell growth pathways where it interacts with RPL4, RPL11, RPL26, RPL27A and RPL35.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
AF1019
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, WB
AF1086
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1224
Species: Hu
Applications: IHC, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
AF169
Species: Hu
Applications: IHC, WB
485-MI
Species: Mu
Applications: BA
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
DR2A00
Species: Hu
Applications: ELISA
NBP2-16996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2365
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, KO, WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB

Publications for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP) (0)

There are no publications for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP) (0)

There are no reviews for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ribosomal Protein L17 Products

Research Areas for Ribosomal Protein L17 Recombinant Protein Antigen (NBP2-48798PEP)

Find related products by research area.

Blogs on Ribosomal Protein L17

There are no specific blogs for Ribosomal Protein L17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ribosomal Protein L17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL17