Ribonuclease Inhibitor Antibody

Images

 
Western Blot: Ribonuclease Inhibitor Antibody [NBP1-87161] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Ribonuclease Inhibitor Antibody [NBP1-87161] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Ribonuclease Inhibitor Antibody [NBP1-87161] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ribonuclease Inhibitor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLAN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ribonuclease Inhibitor Protein (NBP1-87161PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ribonuclease Inhibitor Antibody

  • Placental ribonuclease inhibitor
  • Placental RNase inhibitor
  • PRI
  • RAIMGC4569
  • ribonuclease inhibitor
  • ribonuclease/angiogenin inhibitor 1MGC18200
  • ribonuclease/angiogenin inhibitor
  • RNHMGC54054

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-648
Species: Bv
Applications: WB, ELISA, IP
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NBP2-58795
Species: Hu
Applications: WB, ICC/IF
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Ribonuclease Inhibitor Antibody (NBP1-87161) (0)

There are no publications for Ribonuclease Inhibitor Antibody (NBP1-87161).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribonuclease Inhibitor Antibody (NBP1-87161) (0)

There are no reviews for Ribonuclease Inhibitor Antibody (NBP1-87161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ribonuclease Inhibitor Antibody (NBP1-87161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ribonuclease Inhibitor Products

Bioinformatics Tool for Ribonuclease Inhibitor Antibody (NBP1-87161)

Discover related pathways, diseases and genes to Ribonuclease Inhibitor Antibody (NBP1-87161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribonuclease Inhibitor Antibody (NBP1-87161)

Discover more about diseases related to Ribonuclease Inhibitor Antibody (NBP1-87161).
 

Pathways for Ribonuclease Inhibitor Antibody (NBP1-87161)

View related products by pathway.

PTMs for Ribonuclease Inhibitor Antibody (NBP1-87161)

Learn more about PTMs related to Ribonuclease Inhibitor Antibody (NBP1-87161).

Blogs on Ribonuclease Inhibitor

There are no specific blogs for Ribonuclease Inhibitor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ribonuclease Inhibitor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNH1