Ribonuclease A Antibody

Images

 
Western Blot: Ribonuclease A Antibody [NBP1-69257] - This Anti-RNASE1 antibody was used in Western Blot of Fetal Spleen tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ribonuclease A Antibody Summary

Immunogen
Synthetic peptides corresponding to RNASE1(ribonuclease, RNase A family, 1 (pancreatic)) The peptide sequence was selected from the N terminal of RNASE1. Peptide sequence MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RNASE1 and was validated on Western blot.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ribonuclease A Antibody

  • EC 3.1.27.5
  • HP-RNase
  • MGC12408
  • RIB1
  • RIB-1
  • Ribonuclease 1
  • Ribonuclease A
  • ribonuclease pancreatic
  • ribonuclease, RNase A family, 1 (pancreatic)
  • RNase A
  • RNase UpI-1
  • RNS1RNase 1

Background

This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substr

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03254
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC

Publications for Ribonuclease A Antibody (NBP1-69257) (0)

There are no publications for Ribonuclease A Antibody (NBP1-69257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribonuclease A Antibody (NBP1-69257) (0)

There are no reviews for Ribonuclease A Antibody (NBP1-69257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ribonuclease A Antibody (NBP1-69257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ribonuclease A Products

Bioinformatics Tool for Ribonuclease A Antibody (NBP1-69257)

Discover related pathways, diseases and genes to Ribonuclease A Antibody (NBP1-69257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ribonuclease A Antibody (NBP1-69257)

Discover more about diseases related to Ribonuclease A Antibody (NBP1-69257).
 

Pathways for Ribonuclease A Antibody (NBP1-69257)

View related products by pathway.

PTMs for Ribonuclease A Antibody (NBP1-69257)

Learn more about PTMs related to Ribonuclease A Antibody (NBP1-69257).

Blogs on Ribonuclease A

There are no specific blogs for Ribonuclease A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ribonuclease A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE1
Uniprot