MAP4K1 Antibody

Images

 
Immunohistochemistry-Paraffin: MAP4K1 Antibody [NBP1-83221] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP4K1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP4K1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAP4K1 Protein (NBP1-83221PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP4K1 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • Hematopoietic progenitor kinase
  • HPK1hematopoietic progenitor kinase 1
  • MAPK/ERK kinase kinase kinase 1
  • MEK kinase kinase 1
  • MEKKK 1
  • mitogen-activated protein kinase kinase kinase kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF4559
Species: Hu
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB5526
Species: Hu, Mu
Applications: WB

Publications for MAP4K1 Antibody (NBP1-83221) (0)

There are no publications for MAP4K1 Antibody (NBP1-83221).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K1 Antibody (NBP1-83221) (0)

There are no reviews for MAP4K1 Antibody (NBP1-83221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAP4K1 Antibody (NBP1-83221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP4K1 Products

Bioinformatics Tool for MAP4K1 Antibody (NBP1-83221)

Discover related pathways, diseases and genes to MAP4K1 Antibody (NBP1-83221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP4K1 Antibody (NBP1-83221)

Discover more about diseases related to MAP4K1 Antibody (NBP1-83221).
 

Pathways for MAP4K1 Antibody (NBP1-83221)

View related products by pathway.

PTMs for MAP4K1 Antibody (NBP1-83221)

Learn more about PTMs related to MAP4K1 Antibody (NBP1-83221).
 

Research Areas for MAP4K1 Antibody (NBP1-83221)

Find related products by research area.

Blogs on MAP4K1

There are no specific blogs for MAP4K1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP4K1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP4K1