SKAP55 Antibody (3D3)

Images

 
Immunohistochemistry: SKAP55 Antibody (3D3) [H00008631-M01] - Human SKAP expression by IHC. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: SKAP55 Antibody (3D3) [H00008631-M01] - Analysis of monoclonal antibody to SCAP1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
3D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SKAP55 Antibody (3D3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SCAP1 (AAH47870, 1 a.a. ~ 358 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
Specificity
SCAP1 - src family associated phosphoprotein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SKAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00008631-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SKAP55 Antibody (3D3)

  • SCAP1
  • SCAP1pp55
  • SKAP1
  • SKAP55
  • SKAP55SKAP-55
  • src family associated phosphoprotein 1
  • Src family-associated phosphoprotein 1
  • src kinase associated phosphoprotein 1
  • src kinase-associated phosphoprotein 1
  • Src kinase-associated phosphoprotein of 55 kDa

Background

This gene encodes a T cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique N-terminal region followed by a PH domain and C-terminal SH3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling T-cell antigen receptor stimulation to the activation of integrins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SKAP55 Antibody (H00008631-M01) (0)

There are no publications for SKAP55 Antibody (H00008631-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SKAP55 Antibody (H00008631-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00008631-M01:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry SKAP55 H00008631-M01
Enlarge
4
reviewed by:
Verified Customer
IHC Human 06/16/2017
View

Summary

ApplicationImmunohistochemistry
Sample TestedProstate tissue
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SKAP55 Antibody (H00008631-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
06/16/2017
Application: IHC
Species: Human

Bioinformatics

Gene Symbol SKAP1
Entrez
OMIM
Uniprot