RHPN1 Antibody

Images

 
Immunohistochemistry-Paraffin: RHPN1 Antibody [NBP1-82880] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHPN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFSLLRENFSHAPSPDMSAASLCALEQLMMAQAQECVFEGLSPPASMAPQDCLAQLRLAQEAAQVAAEYRLVHRTMAQPPVHDYVPVSWTALVHVKAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHPN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHPN1 Protein (NBP1-82880PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHPN1 Antibody

  • GTP-Rho-binding protein 1
  • KIAA1929outer dense fiber of sperm tails 5
  • ODF5
  • rhophilin 1
  • RHOPHILIN
  • rhophilin, Rho GTPase binding protein 1
  • rhophilin-1
  • RHPN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB600-792
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-88956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
21050002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-84420
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NB100-624
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1051
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, PEP-ELISA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00054504-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for RHPN1 Antibody (NBP1-82880) (0)

There are no publications for RHPN1 Antibody (NBP1-82880).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHPN1 Antibody (NBP1-82880) (0)

There are no reviews for RHPN1 Antibody (NBP1-82880). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RHPN1 Antibody (NBP1-82880) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHPN1 Products

Bioinformatics Tool for RHPN1 Antibody (NBP1-82880)

Discover related pathways, diseases and genes to RHPN1 Antibody (NBP1-82880). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for RHPN1 Antibody (NBP1-82880)

Find related products by research area.

Blogs on RHPN1

There are no specific blogs for RHPN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHPN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHPN1