Rhophilin 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Rhophilin 2 Antibody [NBP2-13231] - Staining of human appendix shows cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Rhophilin 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHPN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Rhophilin 2 Protein (NBP2-13231PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Rhophilin 2 Antibody - BSA Free

• GTP-Rho-binding protein 2
• P76RBE
• RHOBP
• rhophilin 2,76 kDa RhoB effector protein
• rhophilin, Rho GTPase binding protein 2
• rhophilin-2
• rhophilin-like Rho-GTPase binding protein

Background

The Rhophilin 2 gene encodes a member of the rhophilin family of Ras-homologous (Rho)-GTPase binding proteins. The encoded proteinbinds both GTP- and GDP-bound RhoA and GTP-bound RhoB and may be involved in the organization of the actincytoskeleton. (provided by Ref

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHPN2