Rhophilin 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Rhophilin 2 Antibody [NBP2-13231] - Staining of human appendix shows cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rhophilin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVR EASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHPN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Rhophilin 2 Protein (NBP2-13231PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rhophilin 2 Antibody

  • GTP-Rho-binding protein 2
  • P76RBE
  • RHOBP
  • rhophilin 2,76 kDa RhoB effector protein
  • rhophilin, Rho GTPase binding protein 2
  • rhophilin-2
  • rhophilin-like Rho-GTPase binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38648
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Rhophilin 2 Antibody (NBP2-13231) (0)

There are no publications for Rhophilin 2 Antibody (NBP2-13231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rhophilin 2 Antibody (NBP2-13231) (0)

There are no reviews for Rhophilin 2 Antibody (NBP2-13231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Rhophilin 2 Antibody (NBP2-13231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rhophilin 2 Products

Bioinformatics Tool for Rhophilin 2 Antibody (NBP2-13231)

Discover related pathways, diseases and genes to Rhophilin 2 Antibody (NBP2-13231). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rhophilin 2 Antibody (NBP2-13231)

Discover more about diseases related to Rhophilin 2 Antibody (NBP2-13231).
 

Pathways for Rhophilin 2 Antibody (NBP2-13231)

View related products by pathway.

Research Areas for Rhophilin 2 Antibody (NBP2-13231)

Find related products by research area.

Blogs on Rhophilin 2

There are no specific blogs for Rhophilin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rhophilin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHPN2