RhoGDI Antibody (1E12-2G11)

Images

 
Sandwich ELISA: RhoGDI Antibody (1E12-2G11) [H00000396-M01] - Detection limit for recombinant GST tagged ARHGDIA is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E12-2G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RhoGDI Antibody (1E12-2G11) Summary

Immunogen
ARHGDIA (AAH16031, 1 a.a. - 204 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Specificity
ARHGDIA - Rho GDP dissociation inhibitor (GDI) alpha
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARHGDIA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RhoGDI Antibody (1E12-2G11)

  • GDIA1
  • MGC117248
  • Rho GDI 1
  • Rho GDP dissociation inhibitor (GDI) alpha
  • rho GDP-dissociation inhibitor 1
  • Rho-GDI alpha
  • RHOGDI
  • RHOGDI-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-49854
Species: Hu
Applications: WB, PEP-ELISA
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-33449
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00000396-M01
Species: Hu
Applications: ELISA

Publications for RhoGDI Antibody (H00000396-M01) (0)

There are no publications for RhoGDI Antibody (H00000396-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoGDI Antibody (H00000396-M01) (0)

There are no reviews for RhoGDI Antibody (H00000396-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RhoGDI Antibody (H00000396-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RhoGDI Products

Bioinformatics Tool for RhoGDI Antibody (H00000396-M01)

Discover related pathways, diseases and genes to RhoGDI Antibody (H00000396-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoGDI Antibody (H00000396-M01)

Discover more about diseases related to RhoGDI Antibody (H00000396-M01).
 

Pathways for RhoGDI Antibody (H00000396-M01)

View related products by pathway.

PTMs for RhoGDI Antibody (H00000396-M01)

Learn more about PTMs related to RhoGDI Antibody (H00000396-M01).
 

Research Areas for RhoGDI Antibody (H00000396-M01)

Find related products by research area.

Blogs on RhoGDI

There are no specific blogs for RhoGDI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoGDI Antibody (1E12-2G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGDIA
Entrez
OMIM
Uniprot