RhoG Antibody

Images

 
Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human pancreas shows low expression as expected.
Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human bone marrow shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining in human bone marrow and pancreas tissues using anti-RHOG antibody. Corresponding RHOG RNA-seq data are presented for ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RhoG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25404878). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RhoG Protein (NBP1-88832PEP)
Publications
Read Publication using
NBP1-88832 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25404878).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RhoG Antibody

  • ARHGMGC125835
  • MGC125836
  • ras homolog gene family, member G (rho G)
  • RhoG
  • rho-related GTP-binding protein RhoG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-33645
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NB100-879
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP2-73890
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-32058
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33449
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88832
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RhoG Antibody (NBP1-88832)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RhoG Antibody (NBP1-88832) (0)

There are no reviews for RhoG Antibody (NBP1-88832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoG Antibody (NBP1-88832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RhoG Products

Bioinformatics Tool for RhoG Antibody (NBP1-88832)

Discover related pathways, diseases and genes to RhoG Antibody (NBP1-88832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoG Antibody (NBP1-88832)

Discover more about diseases related to RhoG Antibody (NBP1-88832).
 

Pathways for RhoG Antibody (NBP1-88832)

View related products by pathway.

PTMs for RhoG Antibody (NBP1-88832)

Learn more about PTMs related to RhoG Antibody (NBP1-88832).
 

Research Areas for RhoG Antibody (NBP1-88832)

Find related products by research area.

Blogs on RhoG

There are no specific blogs for RhoG, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOG