RhoG Antibody

Images

 
Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RhoG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RhoG Protein (NBP1-88832PEP)
Publications
Read Publication using
NBP1-88832 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25404878).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RhoG Antibody

  • ARHGMGC125835
  • MGC125836
  • ras homolog gene family, member G (rho G)
  • RhoG
  • rho-related GTP-binding protein RhoG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7070
Species: Hu, Rt
Applications: WB
NB100-875
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-37472
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-32058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33449
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88832
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RhoG Antibody (NBP1-88832)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RhoG Antibody (NBP1-88832) (0)

There are no reviews for RhoG Antibody (NBP1-88832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoG Antibody (NBP1-88832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RhoG Products

Bioinformatics Tool for RhoG Antibody (NBP1-88832)

Discover related pathways, diseases and genes to RhoG Antibody (NBP1-88832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoG Antibody (NBP1-88832)

Discover more about diseases related to RhoG Antibody (NBP1-88832).
 

Pathways for RhoG Antibody (NBP1-88832)

View related products by pathway.

PTMs for RhoG Antibody (NBP1-88832)

Learn more about PTMs related to RhoG Antibody (NBP1-88832).
 

Research Areas for RhoG Antibody (NBP1-88832)

Find related products by research area.

Blogs on RhoG

There are no specific blogs for RhoG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOG