RhoG Antibody - BSA Free

Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human pancreas shows low expression as expected.

Western Blot: RhoG Antibody [NBP1-88832] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: RhoG Antibody [NBP1-88832] - Staining in human bone marrow and pancreas tissues using anti-RHOG antibody. Corresponding RHOG RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RhoG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RhoG Antibody - BSA Free (NBP1-88832) is a polyclonal antibody validated for use in IHC and WB. Anti-RhoG Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25404878). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RhoG Protein (NBP1-88832PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25404878).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RhoG Antibody - BSA Free

• ARHGMGC125835
• MGC125836
• ras homolog gene family, member G (rho G)
• RhoG
• rho-related GTP-binding protein RhoG

Background

RhoG, also known as Rho-related GTP-binding protein RhoG, is a 21kDa 191 amino acid protein. RhoG plays a significant part in cell migration. RhoG has been researched in relation to Tangier disease, intrahepatic cholangiocarcinoma, shigellosis, cholangiocarcinoma, cholesterol and thyroiditis. RhoG has been linked to the axon guidance, cell adhesion, phagocytosis, cell motility and cell growth pathways where it interacts with VAV1, VAV2, ELMO1, MAP3K11 and ARHGDIG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RhoG Antibody (NBP1-88832)(1)

Publication using NBP1-88832

• Sahu A, Kumar S, Sreenivasamurthy SK et al. Host response profile of human brain proteome in toxoplasma encephalitis co-infected with HIV. Clin Proteomics 2014-01-01 [PMID: 25404878] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: RHOG