RhoG Antibody

Images

 
Western Blot: RhoG Antibody [NBP1-79794] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: RhoG Antibody [NBP1-79794] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: N/A Other Working ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RhoG Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHOG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against RHOG and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
RhoG Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RhoG Antibody

  • ARHGMGC125835
  • MGC125836
  • ras homolog gene family, member G (rho G)
  • RhoG
  • rho-related GTP-binding protein RhoG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
27320002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-30945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-875
Species: Hu, Mu, Rt
Applications: WB, IP, PEP-ELISA
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NB100-879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37472
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-32058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33449
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-79794
Species: Hu
Applications: WB, IHC

Publications for RhoG Antibody (NBP1-79794) (0)

There are no publications for RhoG Antibody (NBP1-79794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RhoG Antibody (NBP1-79794) (0)

There are no reviews for RhoG Antibody (NBP1-79794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RhoG Antibody (NBP1-79794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RhoG Products

Bioinformatics Tool for RhoG Antibody (NBP1-79794)

Discover related pathways, diseases and genes to RhoG Antibody (NBP1-79794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RhoG Antibody (NBP1-79794)

Discover more about diseases related to RhoG Antibody (NBP1-79794).
 

Pathways for RhoG Antibody (NBP1-79794)

View related products by pathway.

PTMs for RhoG Antibody (NBP1-79794)

Learn more about PTMs related to RhoG Antibody (NBP1-79794).
 

Research Areas for RhoG Antibody (NBP1-79794)

Find related products by research area.

Blogs on RhoG

There are no specific blogs for RhoG, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RhoG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHOG
Uniprot
COVID-19 update