RHBDL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: RHBDL2 Antibody [NBP1-92332] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RHBDL2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RHBDL2 Antibody - BSA Free (NBP1-92332) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YAVWKPQKQWITLDTGILESPFIYSPEKREEAWRFISY
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHBDL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RHBDL2 Protein (NBP1-92332PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RHBDL2 Antibody - BSA Free

• EC 3.4.21.105
• FLJ20435
• MGC16997
• rhomboid (veinlet, Drosophila)-like 2
• rhomboid protease 2
• rhomboid, veinlet-like 2 (Drosophila)
• Rhomboid-like protein 2
• rhomboid-related protein 2
• RRP2

Background

RHBDL2 is encoded by this gene is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHBDL2