DDX47 Antibody

Images

 
Western Blot: DDX47 Antibody [NBP1-85076] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: DDX47 Antibody [NBP1-85076] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX47 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX47 Protein (NBP1-85076PEP)
Publications
Read Publication using NBP1-85076.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX47 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
  • DEAD box polypeptide 47
  • DEAD box protein 47
  • DKFZp564O176
  • E4-DBP
  • E4-DEAD box protein
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ30012
  • HQ0256
  • MSTP162
  • probable ATP-dependent RNA helicase DDX47
  • RRP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051428-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
H00168400-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-33776
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-71771
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-46849
Species: Hu
Applications: IHC, IP, WB
NBP1-83328
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91825
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB5710
Species: Hu
Applications: WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-20072
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP2-13663
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83211
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-85076
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DDX47 Antibody (NBP1-85076)(1)

Reviews for DDX47 Antibody (NBP1-85076) (0)

There are no reviews for DDX47 Antibody (NBP1-85076). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX47 Antibody (NBP1-85076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX47 Products

Bioinformatics Tool for DDX47 Antibody (NBP1-85076)

Discover related pathways, diseases and genes to DDX47 Antibody (NBP1-85076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX47 Antibody (NBP1-85076)

Discover more about diseases related to DDX47 Antibody (NBP1-85076).
 

Pathways for DDX47 Antibody (NBP1-85076)

View related products by pathway.

Blogs on DDX47

There are no specific blogs for DDX47, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX47