DDX47 Antibody - BSA Free

Western Blot: DDX47 Antibody [NBP1-85076] - Analysis in human cell line NTERA-2.

Immunocytochemistry/Immunofluorescence: DDX47 Antibody [NBP1-85076] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.

Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human rectum shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: DDX47 Antibody [NBP1-85076] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX47 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX47 Antibody - BSA Free (NBP1-85076) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DDX47 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX47
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX47 Protein (NBP1-85076PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX47 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
• DEAD box polypeptide 47
• DEAD box protein 47
• DKFZp564O176
• E4-DBP
• E4-DEAD box protein
• EC 3.6.1
• EC 3.6.4.13
• FLJ30012
• HQ0256
• MSTP162
• probable ATP-dependent RNA helicase DDX47
• RRP3

Background

DDX47 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DDX47 Antibody (NBP1-85076)(1)

Publication using NBP1-85076

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: DDX47