RHBDD1 Antibody

Images

 
Western Blot: RHBDD1 Antibody [NBP1-85092] - Analysis in human cell line K562.
Immunohistochemistry-Paraffin: RHBDD1 Antibody [NBP1-85092] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHBDD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHBDD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RHBDD1 Protein (NBP1-85092PEP)
Publications
Read Publication using NBP1-85092.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHBDD1 Antibody

  • DKFZp547E052
  • EC 3.4.21
  • EC 3.4.21.-
  • MGC117258
  • rhomboid domain containing 1
  • rhomboid domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP2-01732
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56109
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-13395
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20728
Species: Hu
Applications: WB
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-22261
Species: Hu, Mu, Ch
Applications: WB, IP
NBP2-47274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-1574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for RHBDD1 Antibody (NBP1-85092)(1)

Reviews for RHBDD1 Antibody (NBP1-85092) (0)

There are no reviews for RHBDD1 Antibody (NBP1-85092). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHBDD1 Antibody (NBP1-85092) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHBDD1 Products

Bioinformatics Tool for RHBDD1 Antibody (NBP1-85092)

Discover related pathways, diseases and genes to RHBDD1 Antibody (NBP1-85092). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHBDD1 Antibody (NBP1-85092)

Discover more about diseases related to RHBDD1 Antibody (NBP1-85092).
 

Pathways for RHBDD1 Antibody (NBP1-85092)

View related products by pathway.

PTMs for RHBDD1 Antibody (NBP1-85092)

Learn more about PTMs related to RHBDD1 Antibody (NBP1-85092).

Blogs on RHBDD1

There are no specific blogs for RHBDD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHBDD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHBDD1