RFX5 Antibody - BSA Free

Staining of human cell line JURKAT shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RFX5 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein RFX5 using the following amino acid sequence: TVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFX5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RFX5 Antibody - BSA Free

• DNA-binding protein RFX5
• Regulatory factor X 5
• regulatory factor X, 5 (influences HLA class II expression)

Background

RFX5 is the regulatory gene responsible for human MHC class II deficiency. Patients with this disease exhibit a characteristic defect in the binding of a nuclear factor, RFX, to the X box motif of MHC class II promoters. RFX5 is the 75 kDa subunit of the RFX complex which is absolutely essential and highly specific for regulating MHC class II gene expression and control of the immune response. RFX5 is a protein consisting of 616 amino acids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFX5