RFWD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RFWD3 Antibody [NBP2-58819] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFWD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE
Specificity
Specificity of human RFWD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFWD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RFWD3 Antibody

  • EC 6.3.2.-
  • FLJ10520
  • ring finger and WD repeat domain 3
  • RING finger and WD repeat domain-containing protein 3
  • RING finger protein 201
  • RNF201E3 ubiquitin-protein ligase RFWD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu, Rt, Ca, Kg
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00084172-M10
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
AF2288
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-58819
Species: Hu
Applications: ICC/IF

Publications for RFWD3 Antibody (NBP2-58819) (0)

There are no publications for RFWD3 Antibody (NBP2-58819).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFWD3 Antibody (NBP2-58819) (0)

There are no reviews for RFWD3 Antibody (NBP2-58819). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RFWD3 Antibody (NBP2-58819) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RFWD3 Products

Bioinformatics Tool for RFWD3 Antibody (NBP2-58819)

Discover related pathways, diseases and genes to RFWD3 Antibody (NBP2-58819). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFWD3 Antibody (NBP2-58819)

Discover more about diseases related to RFWD3 Antibody (NBP2-58819).
 

Pathways for RFWD3 Antibody (NBP2-58819)

View related products by pathway.

PTMs for RFWD3 Antibody (NBP2-58819)

Learn more about PTMs related to RFWD3 Antibody (NBP2-58819).
 

Research Areas for RFWD3 Antibody (NBP2-58819)

Find related products by research area.

Blogs on RFWD3

There are no specific blogs for RFWD3, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFWD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFWD3
COVID-19 update