RFTN1 Antibody

Images

 
Immunohistochemistry-Paraffin: RFTN1 Antibody [NBP2-14655] - Staining of human tonsil shows cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RFTN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ALHPFVQPTHEREKTPLEHIFRAILIKKTDRSQKTDLHNEGYILELDCCS SLDHPTDQKLIPEFIKKIQEAASQGLKFVGVIPQYHSSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RFTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RFTN1 Protein (NBP2-14655PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RFTN1 Antibody

  • MIG2
  • PIB10
  • PIG9
  • RAFTLIN
  • RFTN1 raftlin, lipid raft linker 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-86807
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00576
Species: Hu
Applications: WB, Flow, ICC/IF
H00007024-B01P
Species: Hu, Mu, Rt
Applications: WB

Publications for RFTN1 Antibody (NBP2-14655) (0)

There are no publications for RFTN1 Antibody (NBP2-14655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RFTN1 Antibody (NBP2-14655) (0)

There are no reviews for RFTN1 Antibody (NBP2-14655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RFTN1 Antibody (NBP2-14655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RFTN1 Products

RFTN1 NBP2-14655

Bioinformatics Tool for RFTN1 Antibody (NBP2-14655)

Discover related pathways, diseases and genes to RFTN1 Antibody (NBP2-14655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RFTN1 Antibody (NBP2-14655)

Discover more about diseases related to RFTN1 Antibody (NBP2-14655).

Blogs on RFTN1

There are no specific blogs for RFTN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RFTN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RFTN1