Rffl Antibody - BSA Free

Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.

Staining of human lymphoid tissues shows strong membranous and cytoplasmic positivity in non-germinal center cells.

Analysis in human cell line CAPAN-2.

Staining of human liver shows moderate membranous and cytoplasmic positivity in hepatocytes.

Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Rffl Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Rffl Antibody - BSA Free (NBP1-83427) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFFL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Rffl Protein (NBP1-83427PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Rffl Antibody - BSA Free

• CARP-2
• Caspase regulator CARP2
• Caspases-8 and -10-associated RING finger protein 2
• E3 ubiquitin-protein ligase rififylin
• EC 6.3.2
• EC 6.3.2.-
• Fring
• FYVE-RING finger protein Sakura
• rififylin
• ring finger and FYVE-like domain containing 1
• RING finger and FYVE-like domain-containing protein 1
• RING finger protein 189
• RING finger protein 34-like
• RNF189CARP2
• RNF34LFRING

Background

RFFL, also known as Rififylin, RING finger and FYVE-like domain-containing protein 1, FYVE-RING finger protein, Sakura, Fring, Caspases-8 and -10-associated RING finger protein 2, CARP-2, Caspase regulator CARP2, RING finger protein 189 and RING finger protein 34-like, is a novel modulator of NF-kB activation. RFFL possesses E3 ubiquitin protein ligase activity and has been shown to regulate the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL also possesses anti-apoptotic activity and may bind phosphatidylinositol phosphates. RFFL is a membrane bound cytoplasmic protein that is expressed ubiquitously. RFFL can be detected in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes and is rapidly degraded after stimulation with TNFSF10, and probably by caspases. Multiple transcript variants have been detected for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFFL