Rffl Antibody


Immunohistochemistry-Paraffin: Rffl Antibody [NBP1-83427] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Rffl Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS
Specificity of human Rffl antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Rffl Protein (NBP1-83427PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Rffl Antibody

  • CARP-2
  • Caspase regulator CARP2
  • Caspases-8 and -10-associated RING finger protein 2
  • E3 ubiquitin-protein ligase rififylin
  • EC 6.3.2
  • EC 6.3.2.-
  • Fring
  • FYVE-RING finger protein Sakura
  • rififylin
  • ring finger and FYVE-like domain containing 1
  • RING finger and FYVE-like domain-containing protein 1
  • RING finger protein 189
  • RING finger protein 34-like
  • RNF189CARP2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC

Publications for Rffl Antibody (NBP1-83427) (0)

There are no publications for Rffl Antibody (NBP1-83427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Rffl Antibody (NBP1-83427) (0)

There are no reviews for Rffl Antibody (NBP1-83427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Rffl Antibody (NBP1-83427) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Rffl Products

Bioinformatics Tool for Rffl Antibody (NBP1-83427)

Discover related pathways, diseases and genes to Rffl Antibody (NBP1-83427). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rffl Antibody (NBP1-83427)

Discover more about diseases related to Rffl Antibody (NBP1-83427).

Pathways for Rffl Antibody (NBP1-83427)

View related products by pathway.

PTMs for Rffl Antibody (NBP1-83427)

Learn more about PTMs related to Rffl Antibody (NBP1-83427).

Blogs on Rffl

There are no specific blogs for Rffl, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Rffl Antibody and receive a gift card or discount.


Gene Symbol RFFL