Rffl Antibody - BSA Free

Western Blot: Rffl Antibody [NBP1-55375] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Rffl Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RFFL (ring finger and FYVE-like domain containing 1) The peptide sequence was selected from the middle region of RFFL)(50ug). Peptide sequence KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RFFL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Rffl Antibody - BSA Free

• CARP-2
• Caspase regulator CARP2
• Caspases-8 and -10-associated RING finger protein 2
• E3 ubiquitin-protein ligase rififylin
• EC 6.3.2
• EC 6.3.2.-
• Fring
• FYVE-RING finger protein Sakura
• rififylin
• ring finger and FYVE-like domain containing 1
• RING finger and FYVE-like domain-containing protein 1
• RING finger protein 189
• RING finger protein 34-like
• RNF189CARP2
• RNF34LFRING

Background

RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. Has anti-apoptotic activity.RFFL may bind phosphatidylinositol phosphates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RFFL
• Uniprot:
  • Q8WZ73(Human)