REXO1L1 Antibody

Images

 
Western Blot: REXO1L1 Antibody [NBP3-09886] - Western blot analysis of REXO1L1 in RPMI-8226 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REXO1L1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human REXO1L1 (NP_758439). Peptide sequence ASSSQRSRGSKVGRQPGKTRNRSGMACKTTATTSSKRIVRRASLPSLSLK
Clonality
Polyclonal
Host
Rabbit
Gene
REXO1L1P
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for REXO1L1 Antibody

  • Antigen GOR Homolog
  • Exonuclease GOR
  • GOR Antigen
  • GOR
  • REX1, RNA Exonuclease 1 Homolog (S. Cerevisiae)-Like 1
  • RNA Exonuclease 1 Homolog-Like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-59197
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-89781
Species: Hu
Applications: IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP3-03702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
AF5129
Species: Hu
Applications: WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB

Publications for REXO1L1 Antibody (NBP3-09886) (0)

There are no publications for REXO1L1 Antibody (NBP3-09886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REXO1L1 Antibody (NBP3-09886) (0)

There are no reviews for REXO1L1 Antibody (NBP3-09886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for REXO1L1 Antibody (NBP3-09886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REXO1L1 Products

Array NBP3-09886

Bioinformatics Tool for REXO1L1 Antibody (NBP3-09886)

Discover related pathways, diseases and genes to REXO1L1 Antibody (NBP3-09886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on REXO1L1

There are no specific blogs for REXO1L1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REXO1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REXO1L1P