Renin R Antibody - BSA Free

Western Blot: Renin R Antibody [NBP2-94053] - Analysis of extracts of various cell lines, using Renin R at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Renin R Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Renin R Antibody - BSA Free (NBP2-94053) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 251-350 of human ATP6AP2 (NP_005756.2). MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6AP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Renin R Antibody - BSA Free

• APT6M8-9
• ATP6AP2
• ATP6IP2
• ATP6M8-9
• ATP6M8-9MRXE
• ATPase H(+)-transporting lysosomal accessory protein 2
• ATPase H(+)-transporting lysosomal-interacting protein 2
• ATPase, H+ transporting, lysosomal accessory protein 2
• ATPase, H+ transporting, lysosomal interacting protein 2
• CAPER
• ELDF10
• Embryonic liver differentiation factor 10
• ER-localized type I transmembrane adaptor
• H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9
• HT028
• M8-9
• MGC99577
• MRXE
• MSTP009
• N14F
• Renin R
• renin receptor
• ReninR
• vacuolar proton ATP synthase membrane sector associated protein M8-9
• V-ATPase M8.9 subunit
• XMRE

Background

Renin receptor encodes a protein which is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6AP2