Renin R Antibody

Images

 
Western Blot: Renin R Antibody [NBP1-90820] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and neuropil.
Western Blot: Renin R Antibody [NBP1-90820] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human renal cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Renin R Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP6AP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in scientific literature (PMID: 25250989).
Control Peptide
Renin R Protein (NBP1-90820PEP)
Publications
Read Publications using
NBP1-90820 in the following applications:

  • 2 publications
  • WB
    3 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23469216)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Renin R Antibody

  • APT6M8-9
  • ATP6AP2
  • ATP6IP2
  • ATP6M8-9
  • ATP6M8-9MRXE
  • ATPase H(+)-transporting lysosomal accessory protein 2
  • ATPase H(+)-transporting lysosomal-interacting protein 2
  • ATPase, H+ transporting, lysosomal accessory protein 2
  • ATPase, H+ transporting, lysosomal interacting protein 2
  • CAPER
  • ELDF10
  • Embryonic liver differentiation factor 10
  • ER-localized type I transmembrane adaptor
  • H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9
  • HT028
  • M8-9
  • MGC99577
  • MRXE
  • MSTP009
  • N14F
  • Renin R
  • renin receptor
  • ReninR
  • vacuolar proton ATP synthase membrane sector associated protein M8-9
  • V-ATPase M8.9 subunit
  • XMRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Renin R Antibody (NBP1-90820)(7)

We have publications tested in 2 confirmed species: Mouse, Rat.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(2)
WB
(3)
All Applications
Filter By Species
Mouse
(1)
Rat
(2)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-90820 Applications Species
Gonzalez AA, Womack JP, Liu L et al. Angiotensin II increases the expression of (pro)renin receptor during low salt conditions in rat renal inner medullary collecting ducts. Am J Med Sci 2014 Nov [PMID: 25250989] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Gonzalez AA, Green T, Luffman C et al. Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension. Am J Physiol Renal Physiol 2014 Oct 15 [PMID: 25143455] (WB, ICC/IF, Rat) WB, ICC/IF Rat
Alva Rosendahl, Gianina Niemann, Sascha Lange et al. Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice. Laboratory Investigation 2014 Aug 01 [PMID: 25046440] (WB, Mouse) WB Mouse
KIRSCH S, SCHREZENMEIER E, KLARE S et al. The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein. Int J Mol Med 2014 Apr [PMID: 24424509]
Zaade D, Schmitz J, Benke E et al. Distinct Signal Transduction Pathways Downstream of the (P)RR Revealed by Microarray and Chromatin Immunoprecipitation-Chromatin Immunoprecipitation Analyses. PLoS One 2013 [PMID: 23469216]
Gonzalez AA, Lara LS, Luffman C et al. Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats. Hypertension 2011 Apr [PMID: 21321306]
Prieto MC, Williams DE, Liu L et al. Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension. Am J Physiol Renal Physiol 2011 Feb [PMID: 21068087]

Reviews for Renin R Antibody (NBP1-90820) (0)

There are no reviews for Renin R Antibody (NBP1-90820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Renin R Antibody (NBP1-90820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Renin R Products

Bioinformatics Tool for Renin R Antibody (NBP1-90820)

Discover related pathways, diseases and genes to Renin R Antibody (NBP1-90820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Renin R Antibody (NBP1-90820)

Discover more about diseases related to Renin R Antibody (NBP1-90820).
 

Pathways for Renin R Antibody (NBP1-90820)

View related products by pathway.

PTMs for Renin R Antibody (NBP1-90820)

Learn more about PTMs related to Renin R Antibody (NBP1-90820).

Blogs on Renin R

There are no specific blogs for Renin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Renin R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6AP2
Entrez