Renin R Antibody - BSA Free

Western Blot: Renin R Antibody [NBP1-90820] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Staining of human cerebellum shows moderate cytoplasmic/ membranous positivity in cells in granular layer

Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Staining of human cerebral cortex shows moderate cytoplasmic/ membranous positivity in neurons and moderately stained neuropil.

Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Staining of human placenta shows moderate cytoplasmic/ membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Renin R Antibody [NBP1-90820] - Staining of human renal cancer shows moderate membranous positivity in tumor cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Renin R Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6AP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB, ICC/IF reported in scientific literature (PMID: 25143455).
• Control Peptide:

  Renin R Protein (NBP1-90820PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23469216). Rat reactivity reported in scientific literature (PMID: 25250989), Mouse reactivity reported in scientific literature (PMID:25046440).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Renin R Antibody - BSA Free

• APT6M8-9
• ATP6AP2
• ATP6IP2
• ATP6M8-9
• ATP6M8-9MRXE
• ATPase H(+)-transporting lysosomal accessory protein 2
• ATPase H(+)-transporting lysosomal-interacting protein 2
• ATPase, H+ transporting, lysosomal accessory protein 2
• ATPase, H+ transporting, lysosomal interacting protein 2
• CAPER
• ELDF10
• Embryonic liver differentiation factor 10
• ER-localized type I transmembrane adaptor
• H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9
• HT028
• M8-9
• MGC99577
• MRXE
• MSTP009
• N14F
• Renin R
• renin receptor
• ReninR
• vacuolar proton ATP synthase membrane sector associated protein M8-9
• V-ATPase M8.9 subunit
• XMRE

Background

Renin receptor encodes a protein which is associated with adenosine triphosphatases (ATPases). Proton-translocating ATPases have fundamental roles in energy conservation, secondary active transport, acidification of intracellular compartments, and cellular pH homeostasis. There are three classes of ATPases- F, P, and V. The vacuolar (V-type) ATPases have a transmembrane proton-conducting sector and an extramembrane catalytic sector. The encoded protein has been found associated with the transmembrane sector of the V-type ATPases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Renin R Antibody (NBP1-90820)(8)

Publications using NBP1-90820

• Senturk M, Lin G, et al. Ubiquilins regulate autophagic flux through mTOR signalling and lysosomal acidification. Nat Cell Biol 2019-03-01 [PMID: 30804504] (WB, Human)
• Gonzalez AA, Womack JP, Liu L et al. Angiotensin II increases the expression of (pro)renin receptor during low salt conditions in rat renal inner medullary collecting ducts. Am J Med Sci 2014-11-01 [PMID: 25250989] (ICC/IF, WB, Rat)
• Gonzalez AA, Green T, Luffman C et al. Renal medullary cyclooxygenase-2 and (pro)renin receptor expression during angiotensin II-dependent hypertension. Am J Physiol Renal Physiol 2014-10-15 [PMID: 25143455] (ICC/IF, WB, Rat)
• Alva Rosendahl, Gianina Niemann, Sascha Lange et al. Increased expression of (pro)renin receptor does not cause hypertension or cardiac and renal fibrosis in mice. Laboratory Investigation 2014-08-01 [PMID: 25046440] (WB, Mouse)
• KIRSCH S, SCHREZENMEIER E, KLARE S et al. The (pro)renin receptor mediates constitutive PLZF-independent pro-proliferative effects which are inhibited by bafilomycin but not genistein. Int J Mol Med 2014-04-01 [PMID: 24424509]
• Zaade D, Schmitz J, Benke E et al. Distinct Signal Transduction Pathways Downstream of the (P)RR Revealed by Microarray and Chromatin Immunoprecipitation-Chromatin Immunoprecipitation Analyses. PLoS One 2013-01-01 [PMID: 23469216]
• Gonzalez AA, Lara LS, Luffman C et al. Soluble form of the (pro)renin receptor is augmented in the collecting duct and urine of chronic angiotensin II-dependent hypertensive rats. Hypertension 2011-04-01 [PMID: 21321306]
• Prieto MC, Williams DE, Liu L et al. Enhancement of renin and prorenin receptor in collecting duct of Cyp1a1-Ren2 rats may contribute to development and progression of malignant hypertension. Am J Physiol Renal Physiol 2011-02-01 [PMID: 21068087]

Bioinformatics

• Gene Symbol: ATP6AP2