REM1 Recombinant Protein Antigen

Images

 
There are currently no images for REM1 Protein (NBP2-13217PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

REM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REM1.

Source: E. coli

Amino Acid Sequence: QEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
REM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13217. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for REM1 Recombinant Protein Antigen

  • GESGD:REM
  • GTPase GES
  • GTPase-regulating endothelial cell sprouting
  • GTP-binding protein REM 1
  • MGC48669
  • Rad and Gem-like GTP-binding protein 1
  • RAS (RAD and GEM)-like GTP-binding 1
  • RAS (RAD and GEM)-like GTP-binding
  • REM

Background

The Ras-encoded family of proteins bind GDP and GTP with high affinity. They possess a low level of intrinsic GTPase activity that increases more than 100-fold when interacting with cytosolic GTPase activating protein (GAP). Ras family members include H-Ras, K-Ras, N-Ras, M-Ras, R-Ras, ERas, Rheb, TC 21, RASL11B and Rad (Ras associated with diabetes) GTPase.Rad GTPase is a GTP-binding protein that is similar to Ras but has unique features. Unlike other small GTPases, Rad GTPase lacks typical pren-ylation motifs at its C terminus. The Rad GTPase enzyme binds calmodulin, inhibits vascular lesion formation, has low intrinsic GTPase activity and cannot be stimulated by any known GAP molecules. Rad GTPase is expressed in skeletal muscle, cardiac muscle and lung tissues and is overexpressed in the skeletal muscle tissue of individuals with type II diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010908-M08
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF-249-NA
Species: Hu
Applications: Neut, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB763
Species: Hu, Mu
Applications: IHC
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00051053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-47927
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13217PEP
Species: Hu
Applications: AC

Publications for REM1 Protein (NBP2-13217PEP) (0)

There are no publications for REM1 Protein (NBP2-13217PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REM1 Protein (NBP2-13217PEP) (0)

There are no reviews for REM1 Protein (NBP2-13217PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for REM1 Protein (NBP2-13217PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REM1 Products

Research Areas for REM1 Protein (NBP2-13217PEP)

Find related products by research area.

Blogs on REM1

There are no specific blogs for REM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our REM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol REM1