REM1 Antibody (3A9)

Product Discontinued

REM1 Antibody (3A9) Summary

• Immunogen: REM1 (NP_054731, 162 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSA
• Specificity: REM1 (3A9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: REM1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for REM1 Antibody (3A9)

• GESGD:REM
• GTPase GES
• GTPase-regulating endothelial cell sprouting
• GTP-binding protein REM 1
• MGC48669
• Rad and Gem-like GTP-binding protein 1
• RAS (RAD and GEM)-like GTP-binding 1
• RAS (RAD and GEM)-like GTP-binding
• REM

Background

The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: REM1
• Entrez:
  • 28954(Human)
• Uniprot:
  • NP_054731(Human)