ENOSF1 Antibody

Images

 
Western Blot: ENOSF1 Antibody [NBP2-13962] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: ENOSF1 Antibody [NBP2-13962] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENOSF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYS TEMKEESVKKHQYPDGEVWKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENOSF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ENOSF1 Protein (NBP2-13962PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ENOSF1 Antibody

  • Antisense RNA to thymidylate synthase
  • EC 5.-
  • enolase superfamily member 1
  • HSRTSBETA
  • rTS beta
  • rTS
  • RTSrTS alpha
  • TYMSASmitochondrial enolase superfamily member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00007357-M03
Species: Hu
Applications: WB, ELISA
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-619
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for ENOSF1 Antibody (NBP2-13962) (0)

There are no publications for ENOSF1 Antibody (NBP2-13962).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENOSF1 Antibody (NBP2-13962) (0)

There are no reviews for ENOSF1 Antibody (NBP2-13962). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ENOSF1 Antibody (NBP2-13962) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENOSF1 Products

ENOSF1 NBP2-13962

Bioinformatics Tool for ENOSF1 Antibody (NBP2-13962)

Discover related pathways, diseases and genes to ENOSF1 Antibody (NBP2-13962). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENOSF1 Antibody (NBP2-13962)

Discover more about diseases related to ENOSF1 Antibody (NBP2-13962).
 

Pathways for ENOSF1 Antibody (NBP2-13962)

View related products by pathway.

Blogs on ENOSF1

There are no specific blogs for ENOSF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENOSF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENOSF1