RCOR1/CoREST Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RCOR1/CoREST Antibody [NBP2-38720] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RCOR1/CoREST Antibody [NBP2-38720] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RCOR1/CoREST Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLV
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RCOR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RCOR1/CoREST Protein (NBP2-38720PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RCOR1/CoREST Antibody

  • CoREST
  • KIAA0071CORESTRCORREST corepressor
  • Protein CoREST
  • RCOR1
  • RCOR1/CoREST
  • REST corepressor 1

Background

Brain type II sodium channels are important in neuronal phenotyping and are only seen at high levels in neurons. Studies have shown that CoREST functions as a corepressor for REST. This interaction between REST and CoREST is accomplished by means of a single zinc finger binding motif originating from REST. Together, the REST-CoREST complex mediates long term repression of the type II sodium channel gene (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RCOR1/CoREST Antibody (NBP2-38720) (0)

There are no publications for RCOR1/CoREST Antibody (NBP2-38720).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCOR1/CoREST Antibody (NBP2-38720) (0)

There are no reviews for RCOR1/CoREST Antibody (NBP2-38720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RCOR1/CoREST Antibody (NBP2-38720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RCOR1/CoREST Products

Research Areas for RCOR1/CoREST Antibody (NBP2-38720)

Find related products by research area.

Blogs on RCOR1/CoREST

There are no specific blogs for RCOR1/CoREST, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RCOR1/CoREST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RCOR1
Uniprot