RCOR1/CoREST Antibody (9B3R7) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCOR1/CoREST (Q9UKL0). MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEH |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
RCOR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation (ChIP) 5ug antibody for 10ug-15ug of Chromatin
- ELISA Recommended starting concentration is 1 μg/mL.
- Immunohistochemistry 1:200 - 1:800
- Immunohistochemistry-Paraffin 1:200 - 1:800
- Immunoprecipitation 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for RCOR1/CoREST Antibody (9B3R7)
Background
Brain type II sodium channels are important in neuronal phenotyping and are only seen at high levels in neurons. Studies have shown that CoREST functions as a corepressor for REST. This interaction between REST and CoREST is accomplished by means of a single zinc finger binding motif originating from REST. Together, the REST-CoREST complex mediates long term repression of the type II sodium channel gene (1).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IP, ChIP
Publications for RCOR1/CoREST Antibody (NBP3-16225)(1)
Showing Publication 1 -
1 of 1.
| Publication using NBP3-16225 |
Applications |
Species |
| Malla, S;Kumari, K;García-Prieto, CA;Caroli, J;Nordin, A;Phan, TTT;Bhattarai, DP;Martinez-Gamero, C;Dorafshan, E;Stransky, S;Álvarez-Errico, D;Saiki, PA;Lai, W;Lyu, C;Lizana, L;Gilthorpe, JD;Wang, H;Sidoli, S;Mateus, A;Lee, DF;Cantù, C;Esteller, M;Mattevi, A;Roman, AC;Aguilo, F; The scaffolding function of LSD1 controls DNA methylation in mouse ESCs Nature communications 2024-09-05 [PMID: 39237615] |
|
|
Reviews for RCOR1/CoREST Antibody (NBP3-16225) (0)
There are no reviews for RCOR1/CoREST Antibody (NBP3-16225).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RCOR1/CoREST Antibody (NBP3-16225) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RCOR1/CoREST Products
Research Areas for RCOR1/CoREST Antibody (NBP3-16225)
Find related products by research area.
|
Blogs on RCOR1/CoREST